6FEG logo
TITLE
SOLUTION STRUCTURE OF CAM/KV7.2-HAB COMPLEX
EXPRESSION SYSTEM(S)
ESCHERICHIA COLI ,
EXPERIMENT TYPE
NMR
ORGANISM(S)
HOMO SAPIENS ,
CLASSIFICATION
METAL TRANSPORT
SPACE GROUP:
P 1
RESOLUTION RANGE HIGH:
--
RESOLUTION RANGE LOW:
--
DOI:
10.1073/PNAS.1800235115
EM DATA RESOURCE:
--
DATE DEPOSITED:
2018-01-02 00:00:00
DATE RELEASED:
2018-02-21 00:00:00
DATE REVISED:
2019-05-08 00:00:00
BIOLOGICAL ASSEMBLY:
--
6FEG logo

3D Structure - 6FEG

3D Viewer

6FEG_B
Loading...

Chains

Structure ChainTarget ProteinGeneExpression SystemOrganismSynonyms
6FEG_B P0DP23 CALM1, CALM, CAM, CAM1 ESCHERICHIA COLI HUMAN CALMODULINMADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAKADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
6FEG_A O43526 KCNQ2 ESCHERICHIA COLI HUMAN KQT-LIKE 2,NEUROBLASTOMA-SPECIFIC POTASSIUM CHANNEL SUBUNITALPHA KVLQT2,VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT KV7.2,KQT-LIKE2,NEUROBLASTOMA-SPECIFIC POTASSIUM CHANNEL SUBUNIT ALPHA KVLQT2,VOLTAGE-GATED POTASSIUM CHANNEL SUBUNIT KV7.2MSYYHHHHHHDYDIPTTENLYFQGAMGILGSGQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRGLEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRLD,MSYYHHHHHHDYDIPTTENLYFQGAMGILGSGQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTWQYYERTVTVPMYRGLEDLTPGLKVSIRAVCVMRFLVSKRKFKESLRLD