6GKT logo

3D Structure - 6GKT

3D Structure View

Loading...

Chains

Structure ChainTarget ProteinGeneExpression SystemOrganismSynonyms
Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.