6GKT logo
TITLE
X-RAY STRUCTURE OF A NON-AUTOCRYSTALLIZING GALECTIN-10 VARIANT, GAL10- TYR69GLU
EXPRESSION SYSTEM(S)
ESCHERICHIA COLI BL21(DE3) ,
EXPERIMENT TYPE
X-RAY DIFFRACTION
ORGANISM(S)
HOMO SAPIENS ,
CLASSIFICATION
SUGAR BINDING PROTEIN
SPACE GROUP:
P 1 21 1
RESOLUTION RANGE HIGH:
2.1
RESOLUTION RANGE LOW:
50
DOI:
10.1126/SCIENCE.AAW4295
EM DATA RESOURCE:
--
DATE DEPOSITED:
2018-05-21 00:00:00
DATE RELEASED:
2019-06-05 00:00:00
DATE REVISED:
--
BIOLOGICAL ASSEMBLY:
--
6GKT logo

3D Structure - 6GKT

3D Viewer

6GKT_E
Loading...

Chains

Structure ChainTarget ProteinGeneExpression SystemOrganismSynonyms
6GKT_B Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
6GKT_A Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
6GKT_E Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
6GKT_C Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
6GKT_D Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.
6GKT_F Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASEWITH AN N-TERMINAL CLEAVABLE HIS-TAG(MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG). THE HIS-TAG WAS REMOVED BYTEV-CLEAVAGE BEFORE CRYSTALLIZATION.