6GKU logo

6GKU

3D Structure View

Loading...

More Info

GENERAL
TITLE
STRUCTURE OF GALECTIN-10 IN COMPLEX WITH THE FAB FRAGMENT OF A CHARCOT-LEYDEN CRYSTAL SOLUBILIZING ANTIBODY, 6F5
DATE LAST MODIFIED
-
RELEASE
5 Jun 2019
OBSOLETE
CLASSIFICATION
SUGAR BINDING PROTEIN
EXPERIMENT TYPE
X-RAY DIFFRACTION
SPACE GROUP
C 2 2 21
RESOLUTION RANGE HIGH
1.91
RESOLUTION RANGE LOW
50
PUBMED ID
DOI
10.1126/SCIENCE.AAW4295

Chains

Structure ChainTarget ProteinGeneExpression SystemOrganismSynonymsActions
Q05315 CLC, LGALS10, LGALS10A ESCHERICHIA COLI BL21(DE3) HUMAN GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPHILLYSOPHOSPHOLIPASE,LYSOLECITHIN ACYLHYDROLASETERMINAL CLEAVABLE HIS-TAG (MASTTHHHHHHDTDIPTTGGGSRPDDDDKENLYFQG).BEFORE CRYSTALLIZATION, THE HIS-TAG WAS CLEAVED BY TEV PROTEASE. HUMAN
GAL-10,CHARCOT-LEYDEN CRYSTAL PROTEIN,CLC,EOSINOPH ...
Mutations
-- HOMO SAPIENS LLAMA -- LLAMA --
P0CF74 -- HOMO SAPIENS LLAMA -- LLAMA --
NGL Viewer is used for the molecular visualization.
  • AS Rose, AR Bradley, Y Valasatava, JM Duarte, A Prlić and PW Rose. NGL viewer: web-based molecular graphics for large complexes. Bioinformatics: bty419, 2018. doi:10.1093/bioinformatics/bty419
  • AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579 first published online April 29, 2015. doi:10.1093/nar/gkv402