6ILS logo

6ILS

3D Structure View

Loading...

More Info

GENERAL
TITLE
STRUCTURE OF ARABIDOPSIS THALIANA RIBOKINASE COMPLEXED WITH RIBOSE AND ATP
DATE LAST MODIFIED
29 Jul 2020
RELEASE
13 Mar 2019
OBSOLETE
CLASSIFICATION
TRANSFERASE
EXPERIMENT TYPE
X-RAY DIFFRACTION
SPACE GROUP
P 42 21 2
RESOLUTION RANGE HIGH
1.75
RESOLUTION RANGE LOW
50
PUBMED ID
DOI
10.1016/J.JSB.2019.02.007
PDBe
--

Chains

Structure ChainTarget ProteinGeneExpression SystemOrganismSynonymsActions
A1A6H3 AT1G17160, F20D23.14, F20D23_14 ESCHERICHIA COLI BL21(DE3) MOUSE-EAR CRESS RKATRBSK. THE REASON FOR TARGET PROTEIN TRUNCATION IS TO REMOVE THEDISORDER. MISS MATCHED SEQUENCE MET67 IS EXPRESSION TAG. THE FULL-MMKGISSVSQSINYNPYIEFNRPQLQISTVNPNPAQSRFSRPRSLRVLSLSADPSANRNPKSAVDAHAPPLVVVGSANADIYVEIERLPKEGETISAKTGQTLAGGKGANQAACGAKLMYPTYFVGRLGEDAHGKLIAEALGDDGCGVHLDYVRSVNNEPTGHAVVMLQSDGQNSIIIVGGANMKAWPEIMSDDDLEIVRNAGIVLLQREIPDSINIQVAKAVKKAGVPVILDVGGMDTPIPNELLDSIDILSPNETELSRLTGMPTETFEQISQAVAKCHKLGVKQVLVKLGSKGSALFIQGEKPIQQSIIPAAQVVDTTGAGDTFTAAFAVAMVEGKSHEECLRFAAAAASLCVQVKGAIPSMPDRKSVLKLLKFSI THEREFORE, N-TERMINAL RESIDUES 1-67 WERE DELETED TO MAKE ATRBSK CRYSTAL. MOUSE-EAR CRESS
RKATRBSK. THE REASON FOR TARGET PROTEIN TRUNCATION ...
Mutations
A1A6H3 AT1G17160, F20D23.14, F20D23_14 ESCHERICHIA COLI BL21(DE3) MOUSE-EAR CRESS RKATRBSK. THE REASON FOR TARGET PROTEIN TRUNCATION IS TO REMOVE THEDISORDER. MISS MATCHED SEQUENCE MET67 IS EXPRESSION TAG. THE FULL-MMKGISSVSQSINYNPYIEFNRPQLQISTVNPNPAQSRFSRPRSLRVLSLSADPSANRNPKSAVDAHAPPLVVVGSANADIYVEIERLPKEGETISAKTGQTLAGGKGANQAACGAKLMYPTYFVGRLGEDAHGKLIAEALGDDGCGVHLDYVRSVNNEPTGHAVVMLQSDGQNSIIIVGGANMKAWPEIMSDDDLEIVRNAGIVLLQREIPDSINIQVAKAVKKAGVPVILDVGGMDTPIPNELLDSIDILSPNETELSRLTGMPTETFEQISQAVAKCHKLGVKQVLVKLGSKGSALFIQGEKPIQQSIIPAAQVVDTTGAGDTFTAAFAVAMVEGKSHEECLRFAAAAASLCVQVKGAIPSMPDRKSVLKLLKFSI THEREFORE, N-TERMINAL RESIDUES 1-67 WERE DELETED TO MAKE ATRBSK CRYSTAL. MOUSE-EAR CRESS
RKATRBSK. THE REASON FOR TARGET PROTEIN TRUNCATION ...
Mutations
NGL Viewer is used for the molecular visualization.
  • AS Rose, AR Bradley, Y Valasatava, JM Duarte, A Prlić and PW Rose. NGL viewer: web-based molecular graphics for large complexes. Bioinformatics: bty419, 2018. doi:10.1093/bioinformatics/bty419
  • AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579 first published online April 29, 2015. doi:10.1093/nar/gkv402